Placeholder image of a protein
Icon representing a puzzle

1252: Unsolved De-novo Freestyle 82

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 26, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,087
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 9,025
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,025
  4. Avatar for Go Science 4. Go Science 33 pts. 9,021
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 9,015
  6. Avatar for Contenders 6. Contenders 14 pts. 8,943
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 8,891
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 5 pts. 8,670
  9. Avatar for Deleted group 9. Deleted group pts. 8,488
  10. Avatar for xkcd 10. xkcd 2 pts. 8,482

  1. Avatar for abiogenesis 101. abiogenesis Lv 1 2 pts. 8,271
  2. Avatar for savinovalex 102. savinovalex Lv 1 2 pts. 8,264
  3. Avatar for ratqueen03 103. ratqueen03 Lv 1 2 pts. 8,262
  4. Avatar for tarimo 104. tarimo Lv 1 1 pt. 8,257
  5. Avatar for Cerzax 105. Cerzax Lv 1 1 pt. 8,234
  6. Avatar for Amphimixus 106. Amphimixus Lv 1 1 pt. 8,234
  7. Avatar for ManVsYard 107. ManVsYard Lv 1 1 pt. 8,230
  8. Avatar for Arne Heessels 108. Arne Heessels Lv 1 1 pt. 8,207
  9. Avatar for Superphosphate 109. Superphosphate Lv 1 1 pt. 8,201
  10. Avatar for uihcv 110. uihcv Lv 1 1 pt. 8,200

Comments