Placeholder image of a protein
Icon representing a puzzle

1252: Unsolved De-novo Freestyle 82

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
June 26, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,087
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 9,025
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,025
  4. Avatar for Go Science 4. Go Science 33 pts. 9,021
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 9,015
  6. Avatar for Contenders 6. Contenders 14 pts. 8,943
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 8,891
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 5 pts. 8,670
  9. Avatar for Deleted group 9. Deleted group pts. 8,488
  10. Avatar for xkcd 10. xkcd 2 pts. 8,482

  1. Avatar for Tehnologik1 61. Tehnologik1 Lv 1 12 pts. 8,625
  2. Avatar for Vinara 62. Vinara Lv 1 12 pts. 8,617
  3. Avatar for phi16 63. phi16 Lv 1 11 pts. 8,606
  4. Avatar for jdormaar 64. jdormaar Lv 1 11 pts. 8,603
  5. Avatar for alwen 65. alwen Lv 1 10 pts. 8,599
  6. Avatar for bendbob 66. bendbob Lv 1 10 pts. 8,584
  7. Avatar for georg137 67. georg137 Lv 1 9 pts. 8,581
  8. Avatar for justjustin 68. justjustin Lv 1 9 pts. 8,581
  9. Avatar for alcor29 69. alcor29 Lv 1 8 pts. 8,578
  10. Avatar for fishercat 70. fishercat Lv 1 8 pts. 8,567

Comments