Placeholder image of a protein
Icon representing a puzzle

1253: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 28, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 8,705
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 8,677
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,523
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,387
  5. Avatar for Team Mexico 15. Team Mexico 1 pt. 8,276
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,098

  1. Avatar for Fetztastic
    1. Fetztastic Lv 1
    100 pts. 9,090
  2. Avatar for Timo van der Laan 2. Timo van der Laan Lv 1 98 pts. 9,041
  3. Avatar for johnmitch 3. johnmitch Lv 1 95 pts. 9,038
  4. Avatar for Scopper 4. Scopper Lv 1 92 pts. 9,035
  5. Avatar for nicobul 5. nicobul Lv 1 90 pts. 9,032
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 87 pts. 9,032
  7. Avatar for pmdpmd 7. pmdpmd Lv 1 85 pts. 9,024
  8. Avatar for gcm24 8. gcm24 Lv 1 82 pts. 9,015
  9. Avatar for reefyrob 9. reefyrob Lv 1 80 pts. 9,012
  10. Avatar for frood66 10. frood66 Lv 1 77 pts. 9,001

Comments