Placeholder image of a protein
Icon representing a puzzle

1253: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
June 28, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 8,705
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 8,677
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,523
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,387
  5. Avatar for Team Mexico 15. Team Mexico 1 pt. 8,276
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,098

  1. Avatar for momadoc 131. momadoc Lv 1 1 pt. 8,410
  2. Avatar for Nsyp 132. Nsyp Lv 1 1 pt. 8,409
  3. Avatar for Maerlyn138 133. Maerlyn138 Lv 1 1 pt. 8,400
  4. Avatar for we646410766 134. we646410766 Lv 1 1 pt. 8,399
  5. Avatar for Hiro Protagonist 135. Hiro Protagonist Lv 1 1 pt. 8,387
  6. Avatar for uihcv 136. uihcv Lv 1 1 pt. 8,363
  7. Avatar for lockert 137. lockert Lv 1 1 pt. 8,346
  8. Avatar for DScott 138. DScott Lv 1 1 pt. 8,332
  9. Avatar for dahast.de 139. dahast.de Lv 1 1 pt. 8,330
  10. Avatar for JW.ORG JEHOVAH 140. JW.ORG JEHOVAH Lv 1 1 pt. 8,307

Comments