Placeholder image of a protein
Icon representing a puzzle

1253: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 28, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 9,090
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 9,041
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 9,032
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,012
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 9,004
  6. Avatar for Contenders 6. Contenders 14 pts. 8,992
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 8 pts. 8,956
  8. Avatar for Deleted group 8. Deleted group pts. 8,816
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 3 pts. 8,792
  10. Avatar for Deleted group 10. Deleted group pts. 8,737

  1. Avatar for tela 91. tela Lv 1 3 pts. 8,651
  2. Avatar for Deleted player 92. Deleted player 3 pts. 8,648
  3. Avatar for Origami314 93. Origami314 Lv 1 3 pts. 8,634
  4. Avatar for pandapharmd 94. pandapharmd Lv 1 3 pts. 8,631
  5. Avatar for ecali 95. ecali Lv 1 3 pts. 8,625
  6. Avatar for Ashrai 96. Ashrai Lv 1 3 pts. 8,619
  7. Avatar for bendbob 97. bendbob Lv 1 2 pts. 8,617
  8. Avatar for alwen 98. alwen Lv 1 2 pts. 8,608
  9. Avatar for carsonfb 99. carsonfb Lv 1 2 pts. 8,608
  10. Avatar for NinjaGreg 100. NinjaGreg Lv 1 2 pts. 8,601

Comments