Placeholder image of a protein
Icon representing a puzzle

1253: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 28, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 9,090
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 9,041
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 9,032
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,012
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 9,004
  6. Avatar for Contenders 6. Contenders 14 pts. 8,992
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 8 pts. 8,956
  8. Avatar for Deleted group 8. Deleted group pts. 8,816
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 3 pts. 8,792
  10. Avatar for Deleted group 10. Deleted group pts. 8,737

  1. Avatar for decbin 111. decbin Lv 1 1 pt. 8,535
  2. Avatar for ViJay7019 112. ViJay7019 Lv 1 1 pt. 8,529
  3. Avatar for rezaefar 113. rezaefar Lv 1 1 pt. 8,524
  4. Avatar for aendgraend 114. aendgraend Lv 1 1 pt. 8,523
  5. Avatar for demeter900 115. demeter900 Lv 1 1 pt. 8,511
  6. Avatar for zugunruhe 116. zugunruhe Lv 1 1 pt. 8,507
  7. Avatar for lucas.wiman 117. lucas.wiman Lv 1 1 pt. 8,505
  8. Avatar for pizpot 118. pizpot Lv 1 1 pt. 8,498
  9. Avatar for Dj-P 119. Dj-P Lv 1 1 pt. 8,498
  10. Avatar for grogar7 120. grogar7 Lv 1 1 pt. 8,489

Comments