Placeholder image of a protein
Icon representing a puzzle

1253: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 28, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 9,090
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 9,041
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 9,032
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,012
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 9,004
  6. Avatar for Contenders 6. Contenders 14 pts. 8,992
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 8 pts. 8,956
  8. Avatar for Deleted group 8. Deleted group pts. 8,816
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 3 pts. 8,792
  10. Avatar for Deleted group 10. Deleted group pts. 8,737

  1. Avatar for alamar 141. alamar Lv 1 1 pt. 8,296
  2. Avatar for heyubob 142. heyubob Lv 1 1 pt. 8,289
  3. Avatar for Arne Heessels 143. Arne Heessels Lv 1 1 pt. 8,278
  4. Avatar for javatlacati 144. javatlacati Lv 1 1 pt. 8,276
  5. Avatar for ManVsYard 145. ManVsYard Lv 1 1 pt. 8,270
  6. Avatar for Denglo 146. Denglo Lv 1 1 pt. 8,268
  7. Avatar for Punktchen 147. Punktchen Lv 1 1 pt. 8,264
  8. Avatar for lamoille 148. lamoille Lv 1 1 pt. 8,259
  9. Avatar for RaeRae61 149. RaeRae61 Lv 1 1 pt. 8,243
  10. Avatar for ZiZ 150. ZiZ Lv 1 1 pt. 8,216

Comments