Placeholder image of a protein
Icon representing a puzzle

1253: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 28, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 9,090
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 9,041
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 9,032
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,012
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 9,004
  6. Avatar for Contenders 6. Contenders 14 pts. 8,992
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 8 pts. 8,956
  8. Avatar for Deleted group 8. Deleted group pts. 8,816
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 3 pts. 8,792
  10. Avatar for Deleted group 10. Deleted group pts. 8,737

  1. Avatar for tarimo 31. tarimo Lv 1 40 pts. 8,898
  2. Avatar for jermainiac 32. jermainiac Lv 1 38 pts. 8,893
  3. Avatar for weitzen 33. weitzen Lv 1 37 pts. 8,891
  4. Avatar for actiasluna 34. actiasluna Lv 1 36 pts. 8,889
  5. Avatar for caglar 35. caglar Lv 1 35 pts. 8,882
  6. Avatar for tokens 36. tokens Lv 1 34 pts. 8,876
  7. Avatar for dcrwheeler 37. dcrwheeler Lv 1 32 pts. 8,876
  8. Avatar for Mike Lewis 38. Mike Lewis Lv 1 31 pts. 8,873
  9. Avatar for KarenCH 39. KarenCH Lv 1 30 pts. 8,866
  10. Avatar for guineapig 40. guineapig Lv 1 29 pts. 8,856

Comments