Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,377
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,159
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,241

  1. Avatar for froggs554 91. froggs554 Lv 1 4 pts. 10,283
  2. Avatar for joaniegirl 92. joaniegirl Lv 1 4 pts. 10,280
  3. Avatar for poiuyqwert 93. poiuyqwert Lv 1 4 pts. 10,275
  4. Avatar for manu8170 94. manu8170 Lv 1 4 pts. 10,250
  5. Avatar for lockert 95. lockert Lv 1 4 pts. 10,227
  6. Avatar for jamiexq 96. jamiexq Lv 1 3 pts. 10,214
  7. Avatar for tarimo 97. tarimo Lv 1 3 pts. 10,193
  8. Avatar for SKSbell 98. SKSbell Lv 1 3 pts. 10,188
  9. Avatar for SouperGenious 99. SouperGenious Lv 1 3 pts. 10,175
  10. Avatar for BCAA 100. BCAA Lv 1 3 pts. 10,159

Comments