Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,377
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,159
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,241

  1. Avatar for Merf 101. Merf Lv 1 3 pts. 10,150
  2. Avatar for ManVsYard 102. ManVsYard Lv 1 3 pts. 10,094
  3. Avatar for guineapig 103. guineapig Lv 1 2 pts. 10,081
  4. Avatar for JUMELLE54 104. JUMELLE54 Lv 1 2 pts. 10,038
  5. Avatar for Deleted player 105. Deleted player pts. 10,024
  6. Avatar for Deleted player 106. Deleted player pts. 9,994
  7. Avatar for Arne Heessels 107. Arne Heessels Lv 1 2 pts. 9,989
  8. Avatar for Superphosphate 108. Superphosphate Lv 1 2 pts. 9,989
  9. Avatar for abiogenesis 109. abiogenesis Lv 1 2 pts. 9,969
  10. Avatar for tela 110. tela Lv 1 2 pts. 9,946

Comments