Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,377
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,159
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,241
  1. Avatar for pvc78 111. pvc78 Lv 1 2 pts. 9,943
  2. Avatar for rezaefar 112. rezaefar Lv 1 2 pts. 9,936
  3. Avatar for sharondipity 113. sharondipity Lv 1 2 pts. 9,929
  4. Avatar for hada 114. hada Lv 1 1 pt. 9,892
  5. Avatar for uihcv 115. uihcv Lv 1 1 pt. 9,885
  6. Avatar for parsnip 116. parsnip Lv 1 1 pt. 9,788
  7. Avatar for rinze 117. rinze Lv 1 1 pt. 9,761
  8. Avatar for Sydefecks 118. Sydefecks Lv 1 1 pt. 9,696
  9. Avatar for Maerlyn138 119. Maerlyn138 Lv 1 1 pt. 9,664
  10. Avatar for khendarg 120. khendarg Lv 1 1 pt. 9,617

Comments