Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,377
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,159
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,241
  1. Avatar for xplocast1 131. xplocast1 Lv 1 1 pt. 9,098
  2. Avatar for Deleted player 132. Deleted player 1 pt. 8,999
  3. Avatar for Tac1 133. Tac1 Lv 1 1 pt. 8,897
  4. Avatar for Deleted player 134. Deleted player pts. 8,835
  5. Avatar for bendbob 135. bendbob Lv 1 1 pt. 8,748
  6. Avatar for pandapharmd 136. pandapharmd Lv 1 1 pt. 8,540
  7. Avatar for relaxmax 137. relaxmax Lv 1 1 pt. 8,520
  8. Avatar for mirjamvandelft 138. mirjamvandelft Lv 1 1 pt. 8,517
  9. Avatar for terashig 139. terashig Lv 1 1 pt. 8,413
  10. Avatar for BMDragon 140. BMDragon Lv 1 1 pt. 8,055

Comments