Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,377
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,159
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,241

  1. Avatar for science-mathguy 141. science-mathguy Lv 1 1 pt. 8,023
  2. Avatar for angeltrouble 142. angeltrouble Lv 1 1 pt. 7,980
  3. Avatar for heyubob 143. heyubob Lv 1 1 pt. 7,966
  4. Avatar for Wheeler22 144. Wheeler22 Lv 1 1 pt. 7,865
  5. Avatar for taminnugget 145. taminnugget Lv 1 1 pt. 7,823
  6. Avatar for FranziS 146. FranziS Lv 1 1 pt. 7,678
  7. Avatar for carsonfb 147. carsonfb Lv 1 1 pt. 7,675
  8. Avatar for pBadMuthaF 148. pBadMuthaF Lv 1 1 pt. 7,631
  9. Avatar for Nsyp 149. Nsyp Lv 1 1 pt. 7,615
  10. Avatar for johngran 150. johngran Lv 1 1 pt. 7,455

Comments