Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,377
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,159
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,241
  1. Avatar for HMK 151. HMK Lv 1 1 pt. 7,412
  2. Avatar for Vmou 152. Vmou Lv 1 1 pt. 7,353
  3. Avatar for aspadistra 153. aspadistra Lv 1 1 pt. 7,241
  4. Avatar for AndrewReedy13 154. AndrewReedy13 Lv 1 1 pt. 7,238
  5. Avatar for Cerzax 155. Cerzax Lv 1 1 pt. 7,213
  6. Avatar for DScott 156. DScott Lv 1 1 pt. 7,206
  7. Avatar for lamoille 157. lamoille Lv 1 1 pt. 7,023
  8. Avatar for emtonsti 158. emtonsti Lv 1 1 pt. 6,947
  9. Avatar for 01010011111 159. 01010011111 Lv 1 1 pt. 6,909
  10. Avatar for Cyberkashi 160. Cyberkashi Lv 1 1 pt. 6,673

Comments