Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,377
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,159
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,241
  1. Avatar for Boffo 171. Boffo Lv 1 1 pt. 5,006
  2. Avatar for BvSG3 172. BvSG3 Lv 1 1 pt. 4,867
  3. Avatar for justinlandicho 173. justinlandicho Lv 1 1 pt. 4,691
  4. Avatar for theWLizard 174. theWLizard Lv 1 1 pt. 4,397
  5. Avatar for emdee314 175. emdee314 Lv 1 1 pt. 4,245
  6. Avatar for metafolder 176. metafolder Lv 1 1 pt. 3,956
  7. Avatar for kazukiyyy 177. kazukiyyy Lv 1 1 pt. 3,950
  8. Avatar for ALostT3ddyBear 178. ALostT3ddyBear Lv 1 1 pt. 0
  9. Avatar for BTScience2016 179. BTScience2016 Lv 1 1 pt. 0
  10. Avatar for pawelbed 180. pawelbed Lv 1 1 pt. 0

Comments