Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,377
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,159
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,241
  1. Avatar for jermainiac 11. jermainiac Lv 1 76 pts. 11,383
  2. Avatar for drumpeter18yrs9yrs 12. drumpeter18yrs9yrs Lv 1 74 pts. 11,380
  3. Avatar for actiasluna 13. actiasluna Lv 1 72 pts. 11,377
  4. Avatar for phi16 14. phi16 Lv 1 70 pts. 11,355
  5. Avatar for Galaxie 15. Galaxie Lv 1 68 pts. 11,310
  6. Avatar for LociOiling 16. LociOiling Lv 1 66 pts. 11,293
  7. Avatar for TastyMunchies 17. TastyMunchies Lv 1 64 pts. 11,254
  8. Avatar for hpaege 18. hpaege Lv 1 63 pts. 11,226
  9. Avatar for Timo van der Laan 19. Timo van der Laan Lv 1 61 pts. 11,148
  10. Avatar for fiendish_ghoul 20. fiendish_ghoul Lv 1 59 pts. 11,130

Comments