Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,377
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,159
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,241

  1. Avatar for g_b 21. g_b Lv 1 57 pts. 11,098
  2. Avatar for MurloW 22. MurloW Lv 1 56 pts. 11,090
  3. Avatar for Scopper 23. Scopper Lv 1 54 pts. 11,082
  4. Avatar for eromana 24. eromana Lv 1 52 pts. 11,060
  5. Avatar for WBarme1234 25. WBarme1234 Lv 1 51 pts. 11,041
  6. Avatar for gdnskye 26. gdnskye Lv 1 49 pts. 11,007
  7. Avatar for aendgraend 27. aendgraend Lv 1 48 pts. 10,981
  8. Avatar for tomespen 28. tomespen Lv 1 46 pts. 10,969
  9. Avatar for nicobul 29. nicobul Lv 1 45 pts. 10,955
  10. Avatar for johnmitch 30. johnmitch Lv 1 44 pts. 10,951

Comments