Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,377
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,159
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,241
  1. Avatar for Vinara 31. Vinara Lv 1 42 pts. 10,940
  2. Avatar for pmdpmd 32. pmdpmd Lv 1 41 pts. 10,934
  3. Avatar for ZeroLeak7 33. ZeroLeak7 Lv 1 40 pts. 10,933
  4. Avatar for andrewxc 34. andrewxc Lv 1 38 pts. 10,930
  5. Avatar for Bletchley Park 35. Bletchley Park Lv 1 37 pts. 10,910
  6. Avatar for fishercat 36. fishercat Lv 1 36 pts. 10,910
  7. Avatar for alwen 37. alwen Lv 1 35 pts. 10,906
  8. Avatar for Museka 38. Museka Lv 1 34 pts. 10,889
  9. Avatar for Bruno Kestemont 39. Bruno Kestemont Lv 1 33 pts. 10,857
  10. Avatar for dcrwheeler 40. dcrwheeler Lv 1 32 pts. 10,854

Comments