Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,377
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,159
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,241
  1. Avatar for TomTaylor 41. TomTaylor Lv 1 31 pts. 10,844
  2. Avatar for mimi 42. mimi Lv 1 30 pts. 10,824
  3. Avatar for KarenCH 43. KarenCH Lv 1 29 pts. 10,821
  4. Avatar for reefyrob 44. reefyrob Lv 1 28 pts. 10,813
  5. Avatar for Mike Lewis 45. Mike Lewis Lv 1 27 pts. 10,797
  6. Avatar for smilingone 46. smilingone Lv 1 26 pts. 10,795
  7. Avatar for spvincent 47. spvincent Lv 1 25 pts. 10,788
  8. Avatar for joremen 48. joremen Lv 1 24 pts. 10,784
  9. Avatar for christioanchauvin 49. christioanchauvin Lv 1 23 pts. 10,762
  10. Avatar for alcor29 50. alcor29 Lv 1 22 pts. 10,759

Comments