Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted Contacts

Summary

Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,377
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,159
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,241
  1. Avatar for Geyalust 71. Geyalust Lv 1 10 pts. 10,493
  2. Avatar for Glen B 72. Glen B Lv 1 10 pts. 10,460
  3. Avatar for diamonddays 73. diamonddays Lv 1 9 pts. 10,455
  4. Avatar for martin.szew 74. martin.szew Lv 1 9 pts. 10,440
  5. Avatar for Deleted player 75. Deleted player pts. 10,432
  6. Avatar for caglar 76. caglar Lv 1 8 pts. 10,420
  7. Avatar for matosfran 77. matosfran Lv 1 8 pts. 10,409
  8. Avatar for Jim Fraser 78. Jim Fraser Lv 1 8 pts. 10,396
  9. Avatar for Amphimixus 79. Amphimixus Lv 1 7 pts. 10,392
  10. Avatar for deLaCeiba 80. deLaCeiba Lv 1 7 pts. 10,377

Comments