Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,377
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,159
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,241
  1. Avatar for edpalas 81. edpalas Lv 1 7 pts. 10,364
  2. Avatar for tallguy-13088 82. tallguy-13088 Lv 1 6 pts. 10,354
  3. Avatar for Pagdzin 83. Pagdzin Lv 1 6 pts. 10,352
  4. Avatar for ecali 84. ecali Lv 1 6 pts. 10,344
  5. Avatar for Crossed Sticks 85. Crossed Sticks Lv 1 6 pts. 10,319
  6. Avatar for harvardman 86. harvardman Lv 1 5 pts. 10,313
  7. Avatar for cinnamonkitty 87. cinnamonkitty Lv 1 5 pts. 10,305
  8. Avatar for Alistair69 88. Alistair69 Lv 1 5 pts. 10,304
  9. Avatar for Punktchen 89. Punktchen Lv 1 5 pts. 10,295
  10. Avatar for demeter900 90. demeter900 Lv 1 4 pts. 10,285

Comments