1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since over 9 years ago

Summary

• Created: July 04, 2016
• Expires: July 11, 2016 at 23:00 UTC
• Max points: 100

Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:

MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

• 1. Anthropic Dreams 100 pts. 12,045
• 2. Contenders 65 pts. 11,898
• 3. Go Science 41 pts. 11,672
• 4. Gargleblasters 24 pts. 11,547
• 5. Beta Folders 14 pts. 11,534
• 6. Deleted group pts. 11,380
• 7. Void Crushers 4 pts. 11,148
• 8. SETI.Germany 2 pts. 10,981
• 9. L'Alliance Francophone 1 pt. 10,955
• 10. Deleted group pts. 10,392

Top evolvers

• 1. Galaxie 100 pts. 12,045
• 2. lamoille 88 pts. 12,040
• 3. jermainiac 77 pts. 12,038
• 4. tokens 68 pts. 12,037
• 5. phi16 59 pts. 11,996
• 6. Vredeman 51 pts. 11,937
• 7. mimi 44 pts. 11,898
• 8. TomTaylor 38 pts. 11,874
• 9. Bletchley Park 32 pts. 11,862
• 10. gitwut 27 pts. 11,824

Comments

[jeff101]

http://foldit.wikia.com/wiki/Distance_Maps and http://memorize.com/distance-and-contact-maps show Distance and Contact Maps along-side their respective 3D images for many different proteins. Images are classified as in the SCOPe database (http://scop.berkeley.edu), and http://memorize.com/distance-and-contact-maps can shuffle the images in multiple-choice and matching modes to help you learn the patterns in them.