Placeholder image of a protein
Icon representing a puzzle

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted Contacts

Summary


Created
July 04, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,045
  2. Avatar for Contenders 2. Contenders 65 pts. 11,898
  3. Avatar for Go Science 3. Go Science 41 pts. 11,672
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 11,547
  5. Avatar for Beta Folders 5. Beta Folders 14 pts. 11,534
  6. Avatar for Deleted group 6. Deleted group pts. 11,380
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 11,148
  8. Avatar for SETI.Germany 8. SETI.Germany 2 pts. 10,981
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 1 pt. 10,955
  10. Avatar for Deleted group 10. Deleted group pts. 10,392

  1. Avatar for pvc78 111. pvc78 Lv 1 2 pts. 9,943
  2. Avatar for rezaefar 112. rezaefar Lv 1 2 pts. 9,936
  3. Avatar for sharondipity 113. sharondipity Lv 1 2 pts. 9,929
  4. Avatar for hada 114. hada Lv 1 1 pt. 9,892
  5. Avatar for uihcv 115. uihcv Lv 1 1 pt. 9,885
  6. Avatar for parsnip 116. parsnip Lv 1 1 pt. 9,788
  7. Avatar for rinze 117. rinze Lv 1 1 pt. 9,761
  8. Avatar for Sydefecks 118. Sydefecks Lv 1 1 pt. 9,696
  9. Avatar for Maerlyn138 119. Maerlyn138 Lv 1 1 pt. 9,664
  10. Avatar for khendarg 120. khendarg Lv 1 1 pt. 9,617

Comments