Foldit

1255: Unsolved De-novo Freestyle 82: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created: July 04, 2016
Expires: July 11, 2016 at 23:00 UTC
Max points: 100

Description

This is a follow-up puzzle for Puzzle 1252, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1252 and use them as a starting point here.

Sequence:

MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

1. Anthropic Dreams
100 pts. 12,045
2. Contenders 65 pts. 11,898
3. Go Science 41 pts. 11,672
4. Gargleblasters 24 pts. 11,547
5. Beta Folders 14 pts. 11,534
6. Deleted group pts. 11,380
7. Void Crushers 4 pts. 11,148
8. SETI.Germany 2 pts. 10,981
9. L'Alliance Francophone 1 pt. 10,955
10. Deleted group pts. 10,392

161. Shadow1138 Lv 1 1 pt. 6,606
162. Fjellryn Lv 1 1 pt. 6,160
163. grulk Lv 1 1 pt. 5,827
164. varjo1 Lv 1 1 pt. 5,647
165. dark_v3ng3nc3 Lv 1 1 pt. 5,563
166. jebbiek Lv 1 1 pt. 5,537
167. Marcell1993 Lv 1 1 pt. 5,196
168. omegablue Lv 1 1 pt. 5,134
169. moanwar.bio12 Lv 1 1 pt. 5,053
170. cerratlan Lv 1 1 pt. 5,010

Comments

jeff101 Lv 1

July 06, 2016

http://foldit.wikia.com/wiki/Distance_Maps and http://memorize.com/distance-and-contact-maps show Distance and Contact Maps along-side their respective 3D images for many different proteins. Images are classified as in the SCOPe database (http://scop.berkeley.edu), and http://memorize.com/distance-and-contact-maps can shuffle the images in multiple-choice and matching modes to help you learn the patterns in them.