Placeholder image of a protein
Icon representing a puzzle

1256: Revisiting Puzzle 60: Beta Barrel

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,785
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,775
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,696
  4. Avatar for Deleted group 14. Deleted group pts. 9,605
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,176
  1. Avatar for Bletchley Park
    1. Bletchley Park Lv 1
    100 pts. 10,471
  2. Avatar for Paulo Roque 2. Paulo Roque Lv 1 85 pts. 10,468
  3. Avatar for pauldunn 3. pauldunn Lv 1 72 pts. 10,466
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 61 pts. 10,466
  5. Avatar for gitwut 5. gitwut Lv 1 51 pts. 10,463
  6. Avatar for Hollinas 6. Hollinas Lv 1 42 pts. 10,463
  7. Avatar for mimi 7. mimi Lv 1 35 pts. 10,453
  8. Avatar for Anfinsen_slept_here 8. Anfinsen_slept_here Lv 1 28 pts. 10,442
  9. Avatar for LociOiling 9. LociOiling Lv 1 23 pts. 10,436
  10. Avatar for smilingone 10. smilingone Lv 1 19 pts. 10,435

Comments