Placeholder image of a protein
Icon representing a puzzle

1256: Revisiting Puzzle 60: Beta Barrel

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,785
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,775
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,696
  4. Avatar for Deleted group 14. Deleted group pts. 9,605
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,176

  1. Avatar for Fetztastic
    1. Fetztastic Lv 1
    100 pts. 10,466
  2. Avatar for gitwut 2. gitwut Lv 1 98 pts. 10,465
  3. Avatar for pauldunn 3. pauldunn Lv 1 95 pts. 10,435
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 93 pts. 10,420
  5. Avatar for LociOiling 5. LociOiling Lv 1 90 pts. 10,413
  6. Avatar for Timo van der Laan 6. Timo van der Laan Lv 1 88 pts. 10,412
  7. Avatar for hpaege 7. hpaege Lv 1 85 pts. 10,408
  8. Avatar for actiasluna 8. actiasluna Lv 1 83 pts. 10,404
  9. Avatar for gcm24 9. gcm24 Lv 1 81 pts. 10,403
  10. Avatar for frood66 10. frood66 Lv 1 78 pts. 10,385

Comments