Placeholder image of a protein
Icon representing a puzzle

1256: Revisiting Puzzle 60: Beta Barrel

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,785
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,775
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,696
  4. Avatar for Deleted group 14. Deleted group pts. 9,605
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,176
  1. Avatar for lockert 121. lockert Lv 1 1 pt. 9,562
  2. Avatar for Arne Heessels 122. Arne Heessels Lv 1 1 pt. 9,546
  3. Avatar for Pietro MSB 123. Pietro MSB Lv 1 1 pt. 9,534
  4. Avatar for lamoille 124. lamoille Lv 1 1 pt. 9,532
  5. Avatar for Wheeler22 125. Wheeler22 Lv 1 1 pt. 9,531
  6. Avatar for pandapharmd 126. pandapharmd Lv 1 1 pt. 9,522
  7. Avatar for roman madala 127. roman madala Lv 1 1 pt. 9,513
  8. Avatar for Graham MF 128. Graham MF Lv 1 1 pt. 9,495
  9. Avatar for DScott 129. DScott Lv 1 1 pt. 9,492
  10. Avatar for rinze 130. rinze Lv 1 1 pt. 9,490

Comments