Placeholder image of a protein
Icon representing a puzzle

1256: Revisiting Puzzle 60: Beta Barrel

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,785
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,775
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,696
  4. Avatar for Deleted group 14. Deleted group pts. 9,605
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,176
  1. Avatar for Idiotboy 11. Idiotboy Lv 1 76 pts. 10,354
  2. Avatar for fiendish_ghoul 12. fiendish_ghoul Lv 1 74 pts. 10,338
  3. Avatar for dembones 13. dembones Lv 1 72 pts. 10,335
  4. Avatar for reefyrob 14. reefyrob Lv 1 70 pts. 10,332
  5. Avatar for Scopper 15. Scopper Lv 1 68 pts. 10,281
  6. Avatar for pmdpmd 16. pmdpmd Lv 1 66 pts. 10,277
  7. Avatar for hansvandenhof 17. hansvandenhof Lv 1 64 pts. 10,266
  8. Avatar for tokens 18. tokens Lv 1 62 pts. 10,254
  9. Avatar for g_b 19. g_b Lv 1 60 pts. 10,221
  10. Avatar for SKSbell 20. SKSbell Lv 1 58 pts. 10,219

Comments