Placeholder image of a protein
Icon representing a puzzle

1256: Revisiting Puzzle 60: Beta Barrel

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,785
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 9,775
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,696
  4. Avatar for Deleted group 14. Deleted group pts. 9,605
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,176
  1. Avatar for KarenCH 21. KarenCH Lv 1 57 pts. 10,182
  2. Avatar for Bruno Kestemont 22. Bruno Kestemont Lv 1 55 pts. 10,162
  3. Avatar for Deleted player 23. Deleted player 53 pts. 10,161
  4. Avatar for TomTaylor 24. TomTaylor Lv 1 52 pts. 10,153
  5. Avatar for nicobul 25. nicobul Lv 1 50 pts. 10,149
  6. Avatar for mimi 26. mimi Lv 1 49 pts. 10,142
  7. Avatar for toshiue 27. toshiue Lv 1 47 pts. 10,141
  8. Avatar for Galaxie 28. Galaxie Lv 1 46 pts. 10,129
  9. Avatar for Punktchen 29. Punktchen Lv 1 44 pts. 10,126
  10. Avatar for Merf 30. Merf Lv 1 43 pts. 10,118

Comments