Placeholder image of a protein
Icon representing a puzzle

1256: Revisiting Puzzle 60: Beta Barrel

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 10,471
  2. Avatar for Go Science 2. Go Science 70 pts. 10,468
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 10,436
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 10,412
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,404
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 11 pts. 10,323
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,277
  8. Avatar for HMT heritage 8. HMT heritage 4 pts. 9,933
  9. Avatar for xkcd 9. xkcd 2 pts. 9,897
  10. Avatar for Deleted group 10. Deleted group pts. 9,879
  1. Avatar for retiredmichael 11. retiredmichael Lv 1 15 pts. 10,426
  2. Avatar for Scopper 12. Scopper Lv 1 12 pts. 10,423
  3. Avatar for reefyrob 13. reefyrob Lv 1 9 pts. 10,422
  4. Avatar for egran48 14. egran48 Lv 1 7 pts. 10,407
  5. Avatar for Blipperman 15. Blipperman Lv 1 5 pts. 10,383
  6. Avatar for Mike Lewis 16. Mike Lewis Lv 1 4 pts. 10,381
  7. Avatar for actiasluna 17. actiasluna Lv 1 3 pts. 10,381
  8. Avatar for ManVsYard 18. ManVsYard Lv 1 2 pts. 10,376
  9. Avatar for smholst 19. smholst Lv 1 2 pts. 10,375
  10. Avatar for dbuske 20. dbuske Lv 1 1 pt. 10,373

Comments