Placeholder image of a protein
Icon representing a puzzle

1256: Revisiting Puzzle 60: Beta Barrel

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Contenders 100 pts. 10,471
  2. Avatar for Go Science 2. Go Science 70 pts. 10,468
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 10,436
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 10,412
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,404
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 11 pts. 10,323
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,277
  8. Avatar for HMT heritage 8. HMT heritage 4 pts. 9,933
  9. Avatar for xkcd 9. xkcd 2 pts. 9,897
  10. Avatar for Deleted group 10. Deleted group pts. 9,879

  1. Avatar for tarimo 91. tarimo Lv 1 4 pts. 9,762
  2. Avatar for navn 92. navn Lv 1 4 pts. 9,761
  3. Avatar for matosfran 93. matosfran Lv 1 4 pts. 9,760
  4. Avatar for smholst 94. smholst Lv 1 3 pts. 9,758
  5. Avatar for pfirth 95. pfirth Lv 1 3 pts. 9,753
  6. Avatar for NinjaGreg 96. NinjaGreg Lv 1 3 pts. 9,746
  7. Avatar for ppp6 97. ppp6 Lv 1 3 pts. 9,722
  8. Avatar for Dev Null 98. Dev Null Lv 1 3 pts. 9,710
  9. Avatar for Origami314 99. Origami314 Lv 1 3 pts. 9,704
  10. Avatar for aendgraend 100. aendgraend Lv 1 3 pts. 9,696

Comments