Placeholder image of a protein
Icon representing a puzzle

1256: Revisiting Puzzle 60: Beta Barrel

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Contenders 100 pts. 10,471
  2. Avatar for Go Science 2. Go Science 70 pts. 10,468
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 10,436
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 10,412
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,404
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 11 pts. 10,323
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,277
  8. Avatar for HMT heritage 8. HMT heritage 4 pts. 9,933
  9. Avatar for xkcd 9. xkcd 2 pts. 9,897
  10. Avatar for Deleted group 10. Deleted group pts. 9,879

  1. Avatar for SouperGenious 101. SouperGenious Lv 1 2 pts. 9,674
  2. Avatar for carsonfb 102. carsonfb Lv 1 2 pts. 9,674
  3. Avatar for IlPero 103. IlPero Lv 1 2 pts. 9,664
  4. Avatar for rezaefar 104. rezaefar Lv 1 2 pts. 9,658
  5. Avatar for harvardman 105. harvardman Lv 1 2 pts. 9,657
  6. Avatar for Alistair69 106. Alistair69 Lv 1 2 pts. 9,657
  7. Avatar for alwen 107. alwen Lv 1 2 pts. 9,654
  8. Avatar for jebbiek 108. jebbiek Lv 1 2 pts. 9,652
  9. Avatar for emaely 109. emaely Lv 1 2 pts. 9,651
  10. Avatar for froggs554 110. froggs554 Lv 1 2 pts. 9,645

Comments