Placeholder image of a protein
Icon representing a puzzle

1256: Revisiting Puzzle 60: Beta Barrel

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Contenders 100 pts. 10,471
  2. Avatar for Go Science 2. Go Science 70 pts. 10,468
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 10,436
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 10,412
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,404
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 11 pts. 10,323
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,277
  8. Avatar for HMT heritage 8. HMT heritage 4 pts. 9,933
  9. Avatar for xkcd 9. xkcd 2 pts. 9,897
  10. Avatar for Deleted group 10. Deleted group pts. 9,879

  1. Avatar for Amphimixus 111. Amphimixus Lv 1 2 pts. 9,605
  2. Avatar for Dodecahedron314 112. Dodecahedron314 Lv 1 1 pt. 9,604
  3. Avatar for Jim Fraser 113. Jim Fraser Lv 1 1 pt. 9,601
  4. Avatar for AndrewReedy13 114. AndrewReedy13 Lv 1 1 pt. 9,601
  5. Avatar for dahast.de 115. dahast.de Lv 1 1 pt. 9,593
  6. Avatar for poiuyqwert 116. poiuyqwert Lv 1 1 pt. 9,592
  7. Avatar for martinf 117. martinf Lv 1 1 pt. 9,584
  8. Avatar for Deleted player 118. Deleted player pts. 9,575
  9. Avatar for angeltrouble 119. angeltrouble Lv 1 1 pt. 9,570
  10. Avatar for abiogenesis 120. abiogenesis Lv 1 1 pt. 9,562

Comments