Placeholder image of a protein
Icon representing a puzzle

1256: Revisiting Puzzle 60: Beta Barrel

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Contenders 100 pts. 10,471
  2. Avatar for Go Science 2. Go Science 70 pts. 10,468
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 10,436
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 10,412
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,404
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 11 pts. 10,323
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,277
  8. Avatar for HMT heritage 8. HMT heritage 4 pts. 9,933
  9. Avatar for xkcd 9. xkcd 2 pts. 9,897
  10. Avatar for Deleted group 10. Deleted group pts. 9,879

  1. Avatar for KarenCH 21. KarenCH Lv 1 57 pts. 10,182
  2. Avatar for Bruno Kestemont 22. Bruno Kestemont Lv 1 55 pts. 10,162
  3. Avatar for Deleted player 23. Deleted player 53 pts. 10,161
  4. Avatar for TomTaylor 24. TomTaylor Lv 1 52 pts. 10,153
  5. Avatar for nicobul 25. nicobul Lv 1 50 pts. 10,149
  6. Avatar for mimi 26. mimi Lv 1 49 pts. 10,142
  7. Avatar for toshiue 27. toshiue Lv 1 47 pts. 10,141
  8. Avatar for Galaxie 28. Galaxie Lv 1 46 pts. 10,129
  9. Avatar for Punktchen 29. Punktchen Lv 1 44 pts. 10,126
  10. Avatar for Merf 30. Merf Lv 1 43 pts. 10,118

Comments