Placeholder image of a protein
Icon representing a puzzle

1256: Revisiting Puzzle 60: Beta Barrel

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Contenders 100 pts. 10,471
  2. Avatar for Go Science 2. Go Science 70 pts. 10,468
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 10,436
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 10,412
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,404
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 11 pts. 10,323
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,277
  8. Avatar for HMT heritage 8. HMT heritage 4 pts. 9,933
  9. Avatar for xkcd 9. xkcd 2 pts. 9,897
  10. Avatar for Deleted group 10. Deleted group pts. 9,879

  1. Avatar for Mike Lewis 51. Mike Lewis Lv 1 21 pts. 10,004
  2. Avatar for bendbob 52. bendbob Lv 1 20 pts. 10,003
  3. Avatar for manu8170 53. manu8170 Lv 1 20 pts. 10,002
  4. Avatar for Satina 54. Satina Lv 1 19 pts. 9,996
  5. Avatar for uihcv 55. uihcv Lv 1 18 pts. 9,991
  6. Avatar for dcrwheeler 56. dcrwheeler Lv 1 17 pts. 9,984
  7. Avatar for ZeroLeak7 57. ZeroLeak7 Lv 1 17 pts. 9,970
  8. Avatar for tela 58. tela Lv 1 16 pts. 9,964
  9. Avatar for eromana 59. eromana Lv 1 16 pts. 9,963
  10. Avatar for cbwest 60. cbwest Lv 1 15 pts. 9,962

Comments