Placeholder image of a protein
Icon representing a puzzle

1256: Revisiting Puzzle 60: Beta Barrel

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Contenders 100 pts. 10,471
  2. Avatar for Go Science 2. Go Science 70 pts. 10,468
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 10,436
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 10,412
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,404
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 11 pts. 10,323
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,277
  8. Avatar for HMT heritage 8. HMT heritage 4 pts. 9,933
  9. Avatar for xkcd 9. xkcd 2 pts. 9,897
  10. Avatar for Deleted group 10. Deleted group pts. 9,879

  1. Avatar for ratqueen03 81. ratqueen03 Lv 1 6 pts. 9,834
  2. Avatar for diamonddays 82. diamonddays Lv 1 6 pts. 9,830
  3. Avatar for phi16 83. phi16 Lv 1 6 pts. 9,829
  4. Avatar for pvc78 84. pvc78 Lv 1 5 pts. 9,822
  5. Avatar for egran48 85. egran48 Lv 1 5 pts. 9,818
  6. Avatar for YeshuaLives 86. YeshuaLives Lv 1 5 pts. 9,794
  7. Avatar for ViJay7019 87. ViJay7019 Lv 1 5 pts. 9,792
  8. Avatar for ManVsYard 88. ManVsYard Lv 1 5 pts. 9,789
  9. Avatar for deLaCeiba 89. deLaCeiba Lv 1 4 pts. 9,785
  10. Avatar for BCAA 90. BCAA Lv 1 4 pts. 9,775

Comments