Placeholder image of a protein
Icon representing a puzzle

1256: Revisiting Puzzle 60: Beta Barrel

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 10,471
  2. Avatar for Go Science 2. Go Science 70 pts. 10,468
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 10,436
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 10,412
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,404
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 11 pts. 10,323
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,277
  8. Avatar for HMT heritage 8. HMT heritage 4 pts. 9,933
  9. Avatar for xkcd 9. xkcd 2 pts. 9,897
  10. Avatar for Deleted group 10. Deleted group pts. 9,879
  1. Avatar for gdnskye 41. gdnskye Lv 1 30 pts. 10,073
  2. Avatar for WBarme1234 42. WBarme1234 Lv 1 29 pts. 10,070
  3. Avatar for Mark- 43. Mark- Lv 1 28 pts. 10,060
  4. Avatar for Pagdzin 44. Pagdzin Lv 1 27 pts. 10,047
  5. Avatar for johnmitch 45. johnmitch Lv 1 26 pts. 10,042
  6. Avatar for guineapig 46. guineapig Lv 1 25 pts. 10,023
  7. Avatar for Deleted player 47. Deleted player 24 pts. 10,015
  8. Avatar for weitzen 48. weitzen Lv 1 23 pts. 10,012
  9. Avatar for joremen 49. joremen Lv 1 23 pts. 10,006
  10. Avatar for jobo0502 50. jobo0502 Lv 1 22 pts. 10,005

Comments