Placeholder image of a protein
Icon representing a puzzle

1261: Tuberculosis Challenge - Phase 2: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
July 18, 2016
Expires
Max points
100
Description

NOTE: The expiration date for this puzzle has been extended by 1 week, due to the size and complexity of the problem.



This is a follow-up puzzle for Puzzle 1258, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1258 and use them as a starting point here. This protein is currently being investigated for drug discovery against Tuberculosis (TB), although its structure is still unknown.



Sequence:


MLTFVARPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR

Top groups


  1. Avatar for Bad Monkey 11. Bad Monkey 4 pts. 9,869
  2. Avatar for freefolder 12. freefolder 3 pts. 9,463
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,067
  4. Avatar for xkcd 14. xkcd 1 pt. 8,879
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,804
  6. Avatar for Team Mexico 16. Team Mexico 1 pt. 7,828
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 7,191
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 1,790
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 0
  10. Avatar for Window Group 20. Window Group 1 pt. 0

  1. Avatar for Vredeman 21. Vredeman Lv 1 67 pts. 11,263
  2. Avatar for tokens 22. tokens Lv 1 66 pts. 11,258
  3. Avatar for pvc78 23. pvc78 Lv 1 64 pts. 11,256
  4. Avatar for dcrwheeler 24. dcrwheeler Lv 1 63 pts. 11,203
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 62 pts. 11,169
  6. Avatar for brow42 26. brow42 Lv 1 60 pts. 11,119
  7. Avatar for nicobul 27. nicobul Lv 1 59 pts. 11,085
  8. Avatar for drumpeter18yrs9yrs 28. drumpeter18yrs9yrs Lv 1 58 pts. 11,061
  9. Avatar for Blipperman 29. Blipperman Lv 1 56 pts. 11,014
  10. Avatar for fiendish_ghoul 30. fiendish_ghoul Lv 1 55 pts. 10,990

Comments


toshiue Lv 1

Closed my client for an hour, restarted, got an automatic update, and was reset to the beginning of the puzzle (1261). None of my saved solutions are listed.

toshiue Lv 1

As mentioned above, the continuation of 1258 and 1261, please consider letting us have such. Am just beginning to get a handle on contact maps, lost my entire puzzle 4 hours ago in a restart and update. Would like to see all this end on a positive note, and actually see if I've learned something going forward. Version 3, please.

Susume Lv 1

Some homologs, like the E. coli, have their catalytic lysine at a different location than the TB, and therefore must have a partially different shape. Is it possible to give more weight to contacts predicted from homologs with the similar active site residue locations, and less weight to contacts from homologs with active site residues located elsewhere?