Placeholder image of a protein
Icon representing a puzzle

1261: Tuberculosis Challenge - Phase 2: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
July 18, 2016
Expires
Max points
100
Description

NOTE: The expiration date for this puzzle has been extended by 1 week, due to the size and complexity of the problem.



This is a follow-up puzzle for Puzzle 1258, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1258 and use them as a starting point here. This protein is currently being investigated for drug discovery against Tuberculosis (TB), although its structure is still unknown.



Sequence:


MLTFVARPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 14,623
  2. Avatar for Contenders 2. Contenders 79 pts. 12,738
  3. Avatar for Beta Folders 3. Beta Folders 61 pts. 12,548
  4. Avatar for Go Science 4. Go Science 47 pts. 12,154
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 11,761
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 11,503
  7. Avatar for Deleted group 7. Deleted group pts. 11,365
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 11,169
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 10 pts. 10,430
  10. Avatar for Deleted group 10. Deleted group pts. 9,907

  1. Avatar for Perhonen 231. Perhonen Lv 1 1 pt. 0
  2. Avatar for Anamfija 232. Anamfija Lv 1 1 pt. 0
  3. Avatar for DudenClarity 233. DudenClarity Lv 1 1 pt. 0
  4. Avatar for Cerzax 234. Cerzax Lv 1 1 pt. 0
  5. Avatar for eusair 235. eusair Lv 1 1 pt. 0
  6. Avatar for tekenhun 236. tekenhun Lv 1 1 pt. 0
  7. Avatar for O Seki To 238. O Seki To Lv 1 1 pt. 0
  8. Avatar for zuomings 239. zuomings Lv 1 1 pt. 0
  9. Avatar for Valantime 240. Valantime Lv 1 1 pt. 0

Comments


toshiue Lv 1

Closed my client for an hour, restarted, got an automatic update, and was reset to the beginning of the puzzle (1261). None of my saved solutions are listed.

toshiue Lv 1

As mentioned above, the continuation of 1258 and 1261, please consider letting us have such. Am just beginning to get a handle on contact maps, lost my entire puzzle 4 hours ago in a restart and update. Would like to see all this end on a positive note, and actually see if I've learned something going forward. Version 3, please.

Susume Lv 1

Some homologs, like the E. coli, have their catalytic lysine at a different location than the TB, and therefore must have a partially different shape. Is it possible to give more weight to contacts predicted from homologs with the similar active site residue locations, and less weight to contacts from homologs with active site residues located elsewhere?