Placeholder image of a protein
Icon representing a puzzle

1268: Unsolved De-novo Freestyle 83

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 04, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ENNAQTTNESAGQKVDSSMNKVGNFMDDSAITAKVKAALVDHDNIKSTDISVKTDQKVVTLSGFVESQAQAEEAVKVAKGVEGVTSVSDKLHVRDAKEGSVKGYAGDTATTSEIKAKLLADDIVPSRHVKVETTDGVVQLSGTVDSQAQSDRAESIAKAVDGVKSVKNDLKTK

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 10,191
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,151
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 9,989
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 9,987
  5. Avatar for Go Science 5. Go Science 22 pts. 9,936
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 9,761
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 9,758
  8. Avatar for Deleted group 8. Deleted group pts. 9,665
  9. Avatar for SETI.Germany 9. SETI.Germany 3 pts. 9,092
  10. Avatar for Bad Monkey 10. Bad Monkey 2 pts. 8,696
  1. Avatar for matosfran 11. matosfran Lv 1 19 pts. 9,978
  2. Avatar for reefyrob 12. reefyrob Lv 1 16 pts. 9,952
  3. Avatar for smilingone 13. smilingone Lv 1 13 pts. 9,948
  4. Avatar for bertro 14. bertro Lv 1 10 pts. 9,941
  5. Avatar for retiredmichael 15. retiredmichael Lv 1 8 pts. 9,940
  6. Avatar for Bruno Kestemont 16. Bruno Kestemont Lv 1 7 pts. 9,936
  7. Avatar for Hollinas 17. Hollinas Lv 1 5 pts. 9,932
  8. Avatar for Paulo Roque 18. Paulo Roque Lv 1 4 pts. 9,928
  9. Avatar for mirp 19. mirp Lv 1 3 pts. 9,925
  10. Avatar for grogar7 20. grogar7 Lv 1 2 pts. 9,901

Comments