Placeholder image of a protein
Icon representing a puzzle

1268: Unsolved De-novo Freestyle 83

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 04, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ENNAQTTNESAGQKVDSSMNKVGNFMDDSAITAKVKAALVDHDNIKSTDISVKTDQKVVTLSGFVESQAQAEEAVKVAKGVEGVTSVSDKLHVRDAKEGSVKGYAGDTATTSEIKAKLLADDIVPSRHVKVETTDGVVQLSGTVDSQAQSDRAESIAKAVDGVKSVKNDLKTK

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 10,191
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,151
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 9,989
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 9,987
  5. Avatar for Go Science 5. Go Science 22 pts. 9,936
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 9,761
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 9,758
  8. Avatar for Deleted group 8. Deleted group pts. 9,665
  9. Avatar for SETI.Germany 9. SETI.Germany 3 pts. 9,092
  10. Avatar for Bad Monkey 10. Bad Monkey 2 pts. 8,696
  1. Avatar for caglar 31. caglar Lv 1 43 pts. 9,467
  2. Avatar for g_b 32. g_b Lv 1 42 pts. 9,420
  3. Avatar for mimi 33. mimi Lv 1 41 pts. 9,411
  4. Avatar for grogar7 34. grogar7 Lv 1 39 pts. 9,392
  5. Avatar for bendbob 35. bendbob Lv 1 38 pts. 9,388
  6. Avatar for hpaege 36. hpaege Lv 1 37 pts. 9,360
  7. Avatar for reefyrob 37. reefyrob Lv 1 36 pts. 9,338
  8. Avatar for Bletchley Park 38. Bletchley Park Lv 1 35 pts. 9,327
  9. Avatar for matosfran 39. matosfran Lv 1 34 pts. 9,313
  10. Avatar for Skippysk8s 40. Skippysk8s Lv 1 33 pts. 9,306

Comments