Placeholder image of a protein
Icon representing a puzzle

1268: Unsolved De-novo Freestyle 83

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 04, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ENNAQTTNESAGQKVDSSMNKVGNFMDDSAITAKVKAALVDHDNIKSTDISVKTDQKVVTLSGFVESQAQAEEAVKVAKGVEGVTSVSDKLHVRDAKEGSVKGYAGDTATTSEIKAKLLADDIVPSRHVKVETTDGVVQLSGTVDSQAQSDRAESIAKAVDGVKSVKNDLKTK

Top groups


  1. Avatar for Contenders 100 pts. 10,191
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,151
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 9,989
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 9,987
  5. Avatar for Go Science 5. Go Science 22 pts. 9,936
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 9,761
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 9,758
  8. Avatar for Deleted group 8. Deleted group pts. 9,665
  9. Avatar for SETI.Germany 9. SETI.Germany 3 pts. 9,092
  10. Avatar for Bad Monkey 10. Bad Monkey 2 pts. 8,696

  1. Avatar for smholst 81. smholst Lv 1 7 pts. 8,598
  2. Avatar for diamonddays 82. diamonddays Lv 1 7 pts. 8,589
  3. Avatar for Threeoak 83. Threeoak Lv 1 7 pts. 8,578
  4. Avatar for Paulo Roque 84. Paulo Roque Lv 1 6 pts. 8,571
  5. Avatar for gurch 85. gurch Lv 1 6 pts. 8,498
  6. Avatar for aznarog 86. aznarog Lv 1 6 pts. 8,467
  7. Avatar for crpainter 87. crpainter Lv 1 6 pts. 8,467
  8. Avatar for smilingone 88. smilingone Lv 1 5 pts. 8,442
  9. Avatar for poiuyqwert 89. poiuyqwert Lv 1 5 pts. 8,437
  10. Avatar for alrianne 90. alrianne Lv 1 5 pts. 8,423

Comments