Placeholder image of a protein
Icon representing a puzzle

1273: Revisiting Puzzle 67: Integrase

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
August 17, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for It's over 9000! 11. It's over 9000! 1 pt. 8,780
  2. Avatar for xkcd 12. xkcd 1 pt. 8,655
  3. Avatar for freefolder 13. freefolder 1 pt. 8,570
  4. Avatar for Herobrine's Army 14. Herobrine's Army 1 pt. 8,347
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,329

  1. Avatar for pauldunn
    1. pauldunn Lv 1
    100 pts. 9,127
  2. Avatar for smilingone 2. smilingone Lv 1 98 pts. 9,101
  3. Avatar for Timo van der Laan 3. Timo van der Laan Lv 1 95 pts. 9,093
  4. Avatar for Deleted player 4. Deleted player pts. 9,092
  5. Avatar for gitwut 5. gitwut Lv 1 90 pts. 9,088
  6. Avatar for mirp 6. mirp Lv 1 88 pts. 9,087
  7. Avatar for bertro 7. bertro Lv 1 85 pts. 9,087
  8. Avatar for Skippysk8s 8. Skippysk8s Lv 1 83 pts. 9,083
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 81 pts. 9,081
  10. Avatar for johnmitch 10. johnmitch Lv 1 79 pts. 9,081

Comments