Placeholder image of a protein
Icon representing a puzzle

1273: Revisiting Puzzle 67: Integrase

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 17, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for It's over 9000! 11. It's over 9000! 1 pt. 8,780
  2. Avatar for xkcd 12. xkcd 1 pt. 8,655
  3. Avatar for freefolder 13. freefolder 1 pt. 8,570
  4. Avatar for Herobrine's Army 14. Herobrine's Army 1 pt. 8,347
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,329

  1. Avatar for TastyMunchies 101. TastyMunchies Lv 1 3 pts. 8,770
  2. Avatar for placid.lion 102. placid.lion Lv 1 3 pts. 8,767
  3. Avatar for Ref_Jo 103. Ref_Jo Lv 1 2 pts. 8,757
  4. Avatar for diamonddays 104. diamonddays Lv 1 2 pts. 8,753
  5. Avatar for mitarcher 105. mitarcher Lv 1 2 pts. 8,743
  6. Avatar for Punktchen 106. Punktchen Lv 1 2 pts. 8,733
  7. Avatar for rinze 107. rinze Lv 1 2 pts. 8,733
  8. Avatar for Deleted player 108. Deleted player pts. 8,732
  9. Avatar for altejoh 109. altejoh Lv 1 2 pts. 8,714
  10. Avatar for poiuyqwert 110. poiuyqwert Lv 1 2 pts. 8,714

Comments