Placeholder image of a protein
Icon representing a puzzle

1273: Revisiting Puzzle 67: Integrase

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 17, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 1 pt. 8,780
  2. Avatar for xkcd 12. xkcd 1 pt. 8,655
  3. Avatar for freefolder 13. freefolder 1 pt. 8,570
  4. Avatar for Herobrine's Army 14. Herobrine's Army 1 pt. 8,347
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,329
  1. Avatar for Sci1217 111. Sci1217 Lv 1 2 pts. 8,712
  2. Avatar for naturacy 112. naturacy Lv 1 2 pts. 8,710
  3. Avatar for uihcv 113. uihcv Lv 1 2 pts. 8,696
  4. Avatar for cherry39 114. cherry39 Lv 1 1 pt. 8,687
  5. Avatar for bendbob 115. bendbob Lv 1 1 pt. 8,676
  6. Avatar for navn 116. navn Lv 1 1 pt. 8,675
  7. Avatar for YorPrints 117. YorPrints Lv 1 1 pt. 8,666
  8. Avatar for Auntecedent 118. Auntecedent Lv 1 1 pt. 8,661
  9. Avatar for fryguy 119. fryguy Lv 1 1 pt. 8,655
  10. Avatar for SouperGenious 120. SouperGenious Lv 1 1 pt. 8,646

Comments