Placeholder image of a protein
Icon representing a puzzle

1273: Revisiting Puzzle 67: Integrase

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
August 17, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for It's over 9000! 11. It's over 9000! 1 pt. 8,780
  2. Avatar for xkcd 12. xkcd 1 pt. 8,655
  3. Avatar for freefolder 13. freefolder 1 pt. 8,570
  4. Avatar for Herobrine's Army 14. Herobrine's Army 1 pt. 8,347
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,329

  1. Avatar for YumatovShow 161. YumatovShow Lv 1 1 pt. 8,333
  2. Avatar for aspadistra 162. aspadistra Lv 1 1 pt. 8,329
  3. Avatar for fishercat 163. fishercat Lv 1 1 pt. 8,313
  4. Avatar for nagistick 164. nagistick Lv 1 1 pt. 8,311
  5. Avatar for justjustin 165. justjustin Lv 1 1 pt. 8,302
  6. Avatar for Pietro MSB 166. Pietro MSB Lv 1 1 pt. 8,299
  7. Avatar for alamar 167. alamar Lv 1 1 pt. 8,294
  8. Avatar for Tac1 168. Tac1 Lv 1 1 pt. 8,292
  9. Avatar for Ciccillo 169. Ciccillo Lv 1 1 pt. 8,292
  10. Avatar for racingsnailrider 170. racingsnailrider Lv 1 1 pt. 8,259

Comments