Placeholder image of a protein
Icon representing a puzzle

1273: Revisiting Puzzle 67: Integrase

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 17, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 1 pt. 8,780
  2. Avatar for xkcd 12. xkcd 1 pt. 8,655
  3. Avatar for freefolder 13. freefolder 1 pt. 8,570
  4. Avatar for Herobrine's Army 14. Herobrine's Army 1 pt. 8,347
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,329
  1. Avatar for jeacom 171. jeacom Lv 1 1 pt. 8,215
  2. Avatar for crackenmeister 172. crackenmeister Lv 1 1 pt. 8,211
  3. Avatar for SmileyHuckerberry 173. SmileyHuckerberry Lv 1 1 pt. 8,207
  4. Avatar for cnhrcolemam 174. cnhrcolemam Lv 1 1 pt. 8,193
  5. Avatar for AEJensen 175. AEJensen Lv 1 1 pt. 8,191
  6. Avatar for trentis1 176. trentis1 Lv 1 1 pt. 8,144
  7. Avatar for cubitus54 177. cubitus54 Lv 1 1 pt. 8,136
  8. Avatar for 5t1q6y 178. 5t1q6y Lv 1 1 pt. 8,130
  9. Avatar for Ukime 179. Ukime Lv 1 1 pt. 7,597
  10. Avatar for JWNoctis 180. JWNoctis Lv 1 1 pt. 7,331

Comments