Placeholder image of a protein
Icon representing a puzzle

1273: Revisiting Puzzle 67: Integrase

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 17, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 1 pt. 8,780
  2. Avatar for xkcd 12. xkcd 1 pt. 8,655
  3. Avatar for freefolder 13. freefolder 1 pt. 8,570
  4. Avatar for Herobrine's Army 14. Herobrine's Army 1 pt. 8,347
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,329
  1. Avatar for minkyuk00 181. minkyuk00 Lv 1 1 pt. 7,329
  2. Avatar for ChemNugget 182. ChemNugget Lv 1 1 pt. 7,234
  3. Avatar for bkoep 183. bkoep Lv 1 1 pt. 7,216
  4. Avatar for 01010011111 184. 01010011111 Lv 1 1 pt. 6,067
  5. Avatar for content 185. content Lv 1 1 pt. 5,442
  6. Avatar for decbin 186. decbin Lv 1 1 pt. 5,442
  7. Avatar for Szogun 187. Szogun Lv 1 1 pt. 5,442
  8. Avatar for Deleted player 188. Deleted player pts. 5,442

Comments