Placeholder image of a protein
Icon representing a puzzle

1273: Revisiting Puzzle 67: Integrase

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
August 17, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,127
  2. Avatar for Gargleblasters 2. Gargleblasters 70 pts. 9,102
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 9,101
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 9,093
  5. Avatar for Contenders 5. Contenders 19 pts. 9,088
  6. Avatar for HMT heritage 6. HMT heritage 11 pts. 9,071
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 7 pts. 9,070
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 4 pts. 9,019
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 8,993
  10. Avatar for Deleted group 10. Deleted group pts. 8,989
  1. Avatar for smholst 11. smholst Lv 1 11 pts. 9,094
  2. Avatar for Skippysk8s 12. Skippysk8s Lv 1 9 pts. 9,089
  3. Avatar for Norrjane 13. Norrjane Lv 1 7 pts. 9,089
  4. Avatar for Deleted player 14. Deleted player 5 pts. 9,088
  5. Avatar for Bletchley Park 15. Bletchley Park Lv 1 4 pts. 9,087
  6. Avatar for gitwut 16. gitwut Lv 1 3 pts. 9,084
  7. Avatar for Galaxie 17. Galaxie Lv 1 2 pts. 9,070
  8. Avatar for dembones 18. dembones Lv 1 1 pt. 9,067
  9. Avatar for mimi 19. mimi Lv 1 1 pt. 9,067
  10. Avatar for georg137 20. georg137 Lv 1 1 pt. 9,065

Comments