Placeholder image of a protein
Icon representing a puzzle

1273: Revisiting Puzzle 67: Integrase

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
August 17, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Go Science 100 pts. 9,127
  2. Avatar for Gargleblasters 2. Gargleblasters 70 pts. 9,102
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 9,101
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 9,093
  5. Avatar for Contenders 5. Contenders 19 pts. 9,088
  6. Avatar for HMT heritage 6. HMT heritage 11 pts. 9,071
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 7 pts. 9,070
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 4 pts. 9,019
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 8,993
  10. Avatar for Deleted group 10. Deleted group pts. 8,989

  1. Avatar for jebbiek 91. jebbiek Lv 1 4 pts. 8,818
  2. Avatar for randomlil 92. randomlil Lv 1 4 pts. 8,815
  3. Avatar for caglar 93. caglar Lv 1 4 pts. 8,812
  4. Avatar for Jesse Pinkman 94. Jesse Pinkman Lv 1 4 pts. 8,809
  5. Avatar for harvardman 95. harvardman Lv 1 4 pts. 8,802
  6. Avatar for rezaefar 96. rezaefar Lv 1 3 pts. 8,797
  7. Avatar for pfirth 98. pfirth Lv 1 3 pts. 8,788
  8. Avatar for BCAA 99. BCAA Lv 1 3 pts. 8,780
  9. Avatar for t012 100. t012 Lv 1 3 pts. 8,780

Comments